PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016651115.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Trihelix
Protein Properties Length: 904aa    MW: 99806.5 Da    PI: 8.6644
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016651115.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix65.89e-21811892186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ +ev +Li++r ++ +r++  k +++lWee+s+++ + g++rsp qCk+ w +l ++y+++ ++ k+  s  ++++pyf++++
  XP_016651115.1 811 KWKPEEVEKLIKMRGKLRSRFQVVKGRMALWEEISRNLLADGINRSPGQCKSLWASLVQKYEQESKSGKR--S--QKSWPYFEEMD 892
                     7**************************************************************9999997..3..556*******7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.60.15.101.8E-67101351IPR001279Metallo-beta-lactamase
SuperFamilySSF562818.58E-72102516IPR001279Metallo-beta-lactamase
SMARTSM008491.8E-25114311IPR001279Metallo-beta-lactamase
PfamPF127061.6E-10126261IPR001279Metallo-beta-lactamase
PfamPF075211.6E-5457488IPR011108Zn-dependent metallo-hydrolase, RNA specificity domain
PROSITE profilePS500908.502804868IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.3E-6805870IPR009057Homeodomain-like
SMARTSM007170.0012808870IPR001005SANT/Myb domain
PfamPF138373.0E-19809892No hitNo description
CDDcd122033.34E-19810872No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009942Biological Processlongitudinal axis specification
GO:0060918Biological Processauxin transport
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 904 aa     Download sequence    Send to blast
MLLGVLGGLS VHHSLCSAPF RPSVSTQMAA FGALSPCPYS LLWRPKPTNR CVSCSVGSSA  60
VTGTRGSNVK RSGRMEGPRK SMEDSVQRKM EQFYEGREGP PIRVLPIGGL GEIGMNCMLV  120
GNYDRYILID AGVMFPDFDE LGVQKIIPDT TFIKKWSHKI EAIVITHGHE DHIGALPWVI  180
PALDPGTPIF ASSFTMELIK KRLKEHGIFV PSRLKTFRTK RKFMAGPFEI EPVRVTHSIP  240
DCCGLVLRCS DGTILHTGDW KIDESPLDGR GFDREALEEL SKEGVTLMMS DSTNVLSPGR  300
TTSETSVADA LLRHISAAKG RVITTQFASN IHRLGSVKAA ADFTGRKLVF VGMSLRTYLD  360
AAWKDGKAPI DPSSLVKVED IDSYAPKDLL IVTTGSQAEP RAALNLASFG SSHSVKLTKE  420
DIILYSAKVI PGNESRVMKM LNRISEIGST IVMGKNEGLH TSGHGYRGEL EEVLQIVKPQ  480
HFLPIHGELL FLKEHELLGR STGIRHTTVI KNGEMLGVSH LRNRRVLSNG FTLLGKENLQ  540
LKFSDGDKAF GTSSELCVDE RLRVALDGII VVSMEILRPQ NVNGLTENSI KGKIKITTRC  600
LWVDKGKLID ALHKAAHAAL SSCPINCPLP HMERTVSEVL RKLVRKYSGK RPDVIAIAME  660
NPAAVLADEV SVRLSGKSHV GSEMSTLRKV IDRHPYKNQS TRTQADEGKD NAHLQSTSQQ  720
DTEESVLEDD GIEVEVLLPE EDSATSNSKS EKLSSDSEKS DDFWNAIVRL STVDKSVVDK  780
NGLAVQQEHL KKDGPDSSEI PNPSKPVKRN KWKPEEVEKL IKMRGKLRSR FQVVKGRMAL  840
WEEISRNLLA DGINRSPGQC KSLWASLVQK YEQESKSGKR SQKSWPYFEE MDGALSDSEE  900
MATK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5a0v_B6e-8910266019560RIBONUCLEASE J
5a0v_A6e-8910266019560RIBONUCLEASE J
5a0t_B6e-8910266019560RIBONUCLEASE J
5a0t_A6e-8910266019560RIBONUCLEASE J
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008239449.10.0PREDICTED: uncharacterized protein LOC103338047
TrEMBLM5WD600.0M5WD60_PRUPE; Uncharacterized protein
STRINGPOPTR_0012s09780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50993450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63420.10.0Trihelix family protein